PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007747m
Common NameCARUB_v10007747mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 172aa    MW: 19911.5 Da    PI: 9.1437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007747mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.7e-164688447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     WT+ Ed++l ++v+ +G ++W++I ++m+ +R++k+c+ rw++ 
  Carubv10007747m 46 WTESEDLKLTELVAAHGFDNWDLIGEKMQ-TRSGKSCRVRWFNQ 88
                     *****************************.***********996 PP

2Myb_DNA-binding46.96.5e-1596140248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++T+eE+ ++v  ++ +G+  W +Iar++  gRt+++++++w+ +l
  Carubv10007747m  96 APFTEEEERIIVSSHNYYGNQ-WVKIARHLK-GRTENDVRHHWNYHL 140
                      68*****************99.********9.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.513689IPR017930Myb domain
SMARTSM007177.7E-134291IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-2744136IPR009057Homeodomain-like
PfamPF002491.1E-154588IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-234596IPR009057Homeodomain-like
CDDcd001676.85E-134687No hitNo description
PROSITE profilePS5129421.86890144IPR017930Myb domain
SMARTSM007174.6E-1494142IPR001005SANT/Myb domain
PfamPF002492.9E-1396140IPR001005SANT/Myb domain
CDDcd001673.28E-1197140No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1997142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDLFLYICNI VLEETLNGVG ANNALPSTET QQEKRKMSSR GGLRHWTESE DLKLTELVAA  60
HGFDNWDLIG EKMQTRSGKS CRVRWFNQLD PTINRAPFTE EEERIIVSSH NYYGNQWVKI  120
ARHLKGRTEN DVRHHWNYHL NRPARGSHIK PKTRYFTPPM NPHGYPGLCP L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-274614210106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286183.11e-128hypothetical protein CARUB_v10007747mg
TrEMBLR0FBF81e-128R0FBF8_9BRAS; Uncharacterized protein
STRINGAT5G39700.13e-47(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17330310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39700.16e-51myb domain protein 89